PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR02G26970.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB
Protein Properties Length: 372aa    MW: 40330.8 Da    PI: 7.8957
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR02G26970.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.51.3e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WTteEd++l +++++ G g+W++ ++  g++R++k+c++rw +yl
  LPERR02G26970.1 14 KGPWTTEEDDKLMEYIQKNGHGSWRALPKLAGLNRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding51.52.3e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T  E + ++++++ lG++ W++Ia++++ gRt++++k++w+++l
  LPERR02G26970.1  67 RGKFTSAEKDTILQLHAVLGNK-WSAIAKHLP-GRTDNEIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.6E-25564IPR009057Homeodomain-like
PROSITE profilePS5129417.43961IPR017930Myb domain
SuperFamilySSF466892.57E-3111108IPR009057Homeodomain-like
SMARTSM007171.5E-131363IPR001005SANT/Myb domain
PfamPF002491.6E-161461IPR001005SANT/Myb domain
CDDcd001672.15E-101661No hitNo description
PROSITE profilePS5129425.32962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.3E-2765117IPR009057Homeodomain-like
SMARTSM007171.5E-1566114IPR001005SANT/Myb domain
PfamPF002494.3E-1567112IPR001005SANT/Myb domain
CDDcd001671.61E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MGRSPCCDEN GLKKGPWTTE EDDKLMEYIQ KNGHGSWRAL PKLAGLNRCG KSCRLRWTNY  60
LRPDIKRGKF TSAEKDTILQ LHAVLGNKWS AIAKHLPGRT DNEIKNYWNT HLKKDLIQKG  120
IDPTTHRPRT DFFAALPQLI ALANLRNLVG QMPWDDPAAS GLQQQQAEAA KFGYMHLQAL  180
LQPPPSTATS PKSGSIAGAM MAGDMEQMGA GLLSPPPMSS LSPLPSPMST SSLSPLPSPM  240
SSTVALSPLP SSSFFNGGHG SFVAGQLPSI HQMHGSSLFN QTPAAIINNS NHNPDYAPNN  300
GATKTTTTLL LSEDSLPPLT DYPAISNLGD VCSATSCDGN ITELPVLSDA LFDELMRDYN  360
HKFWLKGQAT WA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-30121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0050121e-120AP005012.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, PAC clone:P0627E03.
GenBankAP0149581e-120AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015623220.11e-178PREDICTED: myb-related protein Zm38
TrEMBLA0A0D9VL690.0A0A0D9VL69_9ORYZ; Uncharacterized protein
STRINGLOC_Os02g51799.11e-178(Oryza sativa Japonica Group)
STRINGORGLA02G0284500.11e-178(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP112637132
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34670.12e-92myb domain protein 93